(data stored in ACNUC7421 zone)

EMBL: CP000075.PE140

CP000075.PE140       Location/Qualifiers
FT   CDS             151342..152409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0140"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35213"
FT                   /db_xref="GOA:Q500F9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q500F9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35213.1"
FT                   /translation="MLAYVIRRLLLIIPTLLAILIVNFLIVQAAPGGPVEQAIARIQGF
FT                   SPNGVGGGGGEVAASGTASRSTRGLDPALIEQIKQHYGFDKPMHERLWLMLKNYAQLDF
FT                   GTSFFRGAPVTELIAQKLPVSLSLGLWATLITYLISIPLGIRKAVRHGSAFDVWSSTLV
FT                   IIGYATPAFLFAILLIVVFAGGSYLSWFPAQGLFSDNFDSLSTWGKVKDYLWHLVLPVS
FT                   SLVIGGFATLTILTKNSFLNEISRQYVVTARAKGLTEHRVLYGHVFRNAMLLVIAGIPQ
FT                   ALIEVFFAGSLLIETIFGLDGLGRMSYEAAVSRDYPIVFGTLFLFTLFGLLIKLIGDLC
FT                   YTLVDARIDFSARSA"
     MLAYVIRRLL LIIPTLLAIL IVNFLIVQAA PGGPVEQAIA RIQGFSPNGV GGGGGEVAAS        60
     GTASRSTRGL DPALIEQIKQ HYGFDKPMHE RLWLMLKNYA QLDFGTSFFR GAPVTELIAQ       120
     KLPVSLSLGL WATLITYLIS IPLGIRKAVR HGSAFDVWSS TLVIIGYATP AFLFAILLIV       180
     VFAGGSYLSW FPAQGLFSDN FDSLSTWGKV KDYLWHLVLP VSSLVIGGFA TLTILTKNSF       240
     LNEISRQYVV TARAKGLTEH RVLYGHVFRN AMLLVIAGIP QALIEVFFAG SLLIETIFGL       300
     DGLGRMSYEA AVSRDYPIVF GTLFLFTLFG LLIKLIGDLC YTLVDARIDF SARSA            355
//

If you have problems or comments...

PBIL Back to PBIL home page