(data stored in ACNUC7421 zone)

EMBL: CP000075.PE141

CP000075.PE141       Location/Qualifiers
FT   CDS             152409..153431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0141"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35214"
FT                   /db_xref="GOA:Q500F8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q500F8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35214.1"
FT                   /translation="MFEFSPQTRRRFDLFKANRRGWWSLWIFIGLLLVCLCGELIANDK
FT                   PLLIRYDGQLYYPVLHTYMETDFGGELPFEPDYASDYVRKLIAAKNGWMLFAPIPFSYD
FT                   TINYDLDAPSPSPPDHINWLGTDEQARDVLARVLFGARISILFALLLTAISTVIGVCAG
FT                   AIQGYYGGMTDLIGQRIQEIWSGLPVLYLLIILSGFVSPSFWWLLGIMALFSWLSLVDV
FT                   VRAEFLRGRNLEYVKAARALGLTDAALMWRHILPNAMTSTLTYLPFIITGAIATLTALD
FT                   FLGFGMPAGSASLGELIGEAKRNLQAPWLGLTAFVVLALILSLLVFIGEACRDAFDPRS
FT                   "
     MFEFSPQTRR RFDLFKANRR GWWSLWIFIG LLLVCLCGEL IANDKPLLIR YDGQLYYPVL        60
     HTYMETDFGG ELPFEPDYAS DYVRKLIAAK NGWMLFAPIP FSYDTINYDL DAPSPSPPDH       120
     INWLGTDEQA RDVLARVLFG ARISILFALL LTAISTVIGV CAGAIQGYYG GMTDLIGQRI       180
     QEIWSGLPVL YLLIILSGFV SPSFWWLLGI MALFSWLSLV DVVRAEFLRG RNLEYVKAAR       240
     ALGLTDAALM WRHILPNAMT STLTYLPFII TGAIATLTAL DFLGFGMPAG SASLGELIGE       300
     AKRNLQAPWL GLTAFVVLAL ILSLLVFIGE ACRDAFDPRS                             340
//

If you have problems or comments...

PBIL Back to PBIL home page