(data stored in ACNUC7421 zone)

EMBL: CP000075.PE147

CP000075.PE147       Location/Qualifiers
FT   CDS             159893..160822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0147"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35220"
FT                   /db_xref="GOA:Q500F2"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q500F2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35220.1"
FT                   /translation="MPALLYKADPARAERWRVLFAEHAPDIEWRVWPDIGDPADIHYLG
FT                   AWLAPDDLQELLPNLKVLFALSAGVDQLDLSRIPKSLPVVRLLDPGISHAMCEYATFAV
FT                   LSLHREMLRYRQQQVEGVWKAHPLIPANQRRVGVMGLGLQAQHILSSLKPFGFELSGWA
FT                   RSEHRIDAVQCYAGEEQLDAFLGQCDILLCVLPLTGQTEGILNRRLFEQLPKGAALINM
FT                   GRGGHLVEAELIEALDSGQLSAAVLDVLQQEPAAADHPFWTHPKILLTPHVAAMTQPES
FT                   AFPGLLDNIRRFERGEAMQGQVDRGQGY"
     MPALLYKADP ARAERWRVLF AEHAPDIEWR VWPDIGDPAD IHYLGAWLAP DDLQELLPNL        60
     KVLFALSAGV DQLDLSRIPK SLPVVRLLDP GISHAMCEYA TFAVLSLHRE MLRYRQQQVE       120
     GVWKAHPLIP ANQRRVGVMG LGLQAQHILS SLKPFGFELS GWARSEHRID AVQCYAGEEQ       180
     LDAFLGQCDI LLCVLPLTGQ TEGILNRRLF EQLPKGAALI NMGRGGHLVE AELIEALDSG       240
     QLSAAVLDVL QQEPAAADHP FWTHPKILLT PHVAAMTQPE SAFPGLLDNI RRFERGEAMQ       300
     GQVDRGQGY                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page