(data stored in ACNUC7421 zone)

EMBL: CP000075.PE15

CP000075.PE15        Location/Qualifiers
FT   CDS             complement(16812..19175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0015"
FT                   /product="Oxidoreductase alpha (molybdopterin) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35089"
FT                   /db_xref="GOA:Q500T3"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:Q500T3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35089.1"
FT                   /translation="MSESENSQAPLQGSQTDGTPAGGWAALSAVNKHLLHQHVLIKGNR
FT                   TLMSMNKPGGFDCPSCSWPDPKKPHTFEYCENGAKALAWESTKKRVTPEFFARHTVSEL
FT                   ATWSDHELEAEGRITEPMRYDAATDKYLPVTWDEAFAEIGEELRNLSDPWKLELYTSGR
FT                   TSNEAAFLYQLFGRMYGMANFPDCSNMCHETTTAALPESIGVGKGTTTLEDFESADAIF
FT                   IIGQNPGTNSPRMMSELHAAARRGASIISFNPLRERALVRFAAPQDPRDMLSLHGVEIS
FT                   SQYHQVRIGGDMIALQGVCKAVIEADDVAQREHLPRVLDVAFIEEHTHGFEQYADYCRQ
FT                   LPWDIIERHSGLTRQAIEEVAAVYKRSKGVICCWGMGITQHKRGGDAMQQIINLLLLRG
FT                   NIGKLGAGACPVRGHSNVQGDRTMGIYEKAGEPFLASMSKVFGFEASRKKGHAVAETCE
FT                   ALLRGEVEALISMGGNFFRAIPDTDVICPTVSRLKMTVLVNTKLNRSATVHGQKAFLLP
FT                   CVARSERDLQNGVAQTITVEDSMSMVHGSTGMLEPASKHLISEVAIIAGIAKATLAPNP
FT                   KVDWDSYVGDYSRIRDKIEEVLPEQFYDFNQRILEPGGFRLPNAASERKWDTESGKANF
FT                   LFPEGIYDEDDTPPGAEHLQLMTIRSHDQFNTTVYSNDDRYRDIFGDRMVVMLNPQDIE
FT                   RLGLKAGDYIEFQTALDPTTARRAAGFKVIPYDVPQGCCAAYYPETNGLLPLANRDKHG
FT                   NTPAAKSIPVNLVRMSSEGTQVALERRGLIAAAS"
     MSESENSQAP LQGSQTDGTP AGGWAALSAV NKHLLHQHVL IKGNRTLMSM NKPGGFDCPS        60
     CSWPDPKKPH TFEYCENGAK ALAWESTKKR VTPEFFARHT VSELATWSDH ELEAEGRITE       120
     PMRYDAATDK YLPVTWDEAF AEIGEELRNL SDPWKLELYT SGRTSNEAAF LYQLFGRMYG       180
     MANFPDCSNM CHETTTAALP ESIGVGKGTT TLEDFESADA IFIIGQNPGT NSPRMMSELH       240
     AAARRGASII SFNPLRERAL VRFAAPQDPR DMLSLHGVEI SSQYHQVRIG GDMIALQGVC       300
     KAVIEADDVA QREHLPRVLD VAFIEEHTHG FEQYADYCRQ LPWDIIERHS GLTRQAIEEV       360
     AAVYKRSKGV ICCWGMGITQ HKRGGDAMQQ IINLLLLRGN IGKLGAGACP VRGHSNVQGD       420
     RTMGIYEKAG EPFLASMSKV FGFEASRKKG HAVAETCEAL LRGEVEALIS MGGNFFRAIP       480
     DTDVICPTVS RLKMTVLVNT KLNRSATVHG QKAFLLPCVA RSERDLQNGV AQTITVEDSM       540
     SMVHGSTGML EPASKHLISE VAIIAGIAKA TLAPNPKVDW DSYVGDYSRI RDKIEEVLPE       600
     QFYDFNQRIL EPGGFRLPNA ASERKWDTES GKANFLFPEG IYDEDDTPPG AEHLQLMTIR       660
     SHDQFNTTVY SNDDRYRDIF GDRMVVMLNP QDIERLGLKA GDYIEFQTAL DPTTARRAAG       720
     FKVIPYDVPQ GCCAAYYPET NGLLPLANRD KHGNTPAAKS IPVNLVRMSS EGTQVALERR       780
     GLIAAAS                                                                 787
//

If you have problems or comments...

PBIL Back to PBIL home page