(data stored in ACNUC7421 zone)

EMBL: CP000075.PE153

CP000075.PE153       Location/Qualifiers
FT   CDS             complement(166469..166780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35226"
FT                   /db_xref="GOA:Q500E6"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:Q500E6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35226.1"
FT                   /translation="MNGRFVRLGERDRPVVSLMVDGAPIEALQGDTLMVALLTRKATLR
FT                   QSEFDPGRRAGFCLMGACQDCWVWSRSGERLRACSNEVRDGLDIVTTQPEAKWPLLHG"
     MNGRFVRLGE RDRPVVSLMV DGAPIEALQG DTLMVALLTR KATLRQSEFD PGRRAGFCLM        60
     GACQDCWVWS RSGERLRACS NEVRDGLDIV TTQPEAKWPL LHG                         103
//

If you have problems or comments...

PBIL Back to PBIL home page