(data stored in ACNUC7421 zone)

EMBL: CP000075.PE154

CP000075.PE154       Location/Qualifiers
FT   CDS             complement(166777..168618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0154"
FT                   /product="Oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35227"
FT                   /db_xref="GOA:Q500E5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q500E5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35227.1"
FT                   /translation="MSQLIRVQDLRVVADGDHGELEIVKGVSFALEKGEVLALIGESGS
FT                   GKTTIALALLGYARRGCKLAGGVVQVGAHDMLSLPESQLQGLRGNRVSYIAQSAAAAFN
FT                   PAKKLIDQVIEGALIHGLGSRAELEAKAVELFRDLALPNPESIGRRYPHQVSGGQLQRV
FT                   MAAMALISDPLLVILDEPTTALDVTTQIDVLRAFKRVVRDRGATAVYVSHDLAVVAQMA
FT                   DQIVVLNGGRIIEQSSTAALLKGPVDAYSRSLLAAARPDKVLSPASEVVKDSTLLTIKG
FT                   LTAGYGKKNLQGMPMIRVLEDIDLTIRRGQAIGVIGESGSGKSTLARVVAGLLDPAHGS
FT                   LTFDGADLSGTLAGRTEEQFRRIQMVFQNADTALNPMHSISAILARPLKMYFGLKGRAL
FT                   RERIDELMDLVRLPRELAERRPNELSGGQKQRVNLARALAAKPDLILCDEVTSALDTVV
FT                   GACILELLGELRRKLGVSYLFISHDISTVRALCDDIVVMYSGHKVEEGSREAFSRVPFH
FT                   PYTDLLVHSVPELRQGWLETCGVTSGNLPPISAPANNPELCTFLNRCPARIEGLCNKTA
FT                   PGRRLIAGGSEILCHRDSDELQAVQENLNPETVGAYA"
     MSQLIRVQDL RVVADGDHGE LEIVKGVSFA LEKGEVLALI GESGSGKTTI ALALLGYARR        60
     GCKLAGGVVQ VGAHDMLSLP ESQLQGLRGN RVSYIAQSAA AAFNPAKKLI DQVIEGALIH       120
     GLGSRAELEA KAVELFRDLA LPNPESIGRR YPHQVSGGQL QRVMAAMALI SDPLLVILDE       180
     PTTALDVTTQ IDVLRAFKRV VRDRGATAVY VSHDLAVVAQ MADQIVVLNG GRIIEQSSTA       240
     ALLKGPVDAY SRSLLAAARP DKVLSPASEV VKDSTLLTIK GLTAGYGKKN LQGMPMIRVL       300
     EDIDLTIRRG QAIGVIGESG SGKSTLARVV AGLLDPAHGS LTFDGADLSG TLAGRTEEQF       360
     RRIQMVFQNA DTALNPMHSI SAILARPLKM YFGLKGRALR ERIDELMDLV RLPRELAERR       420
     PNELSGGQKQ RVNLARALAA KPDLILCDEV TSALDTVVGA CILELLGELR RKLGVSYLFI       480
     SHDISTVRAL CDDIVVMYSG HKVEEGSREA FSRVPFHPYT DLLVHSVPEL RQGWLETCGV       540
     TSGNLPPISA PANNPELCTF LNRCPARIEG LCNKTAPGRR LIAGGSEILC HRDSDELQAV       600
     QENLNPETVG AYA                                                          613
//

If you have problems or comments...

PBIL Back to PBIL home page