(data stored in ACNUC7421 zone)

EMBL: CP000075.PE156

CP000075.PE156       Location/Qualifiers
FT   CDS             complement(169495..170451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0156"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35229"
FT                   /db_xref="GOA:Q500E3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q500E3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35229.1"
FT                   /translation="MNSNTLWLIVQRFGAAIVTLLIVSIVVFAITAVLPGDAAQQALGQ
FT                   FATPEQVAALRTQLGLDQPGVVRYLHWLTNLLGGNLGESVSNAMPVSELIAGRFPKTLM
FT                   LSATTALVSVPVALALGIGAAMYRGSRLDSALNFITLSLVAVPEFLVATLAVLIFAVNL
FT                   GWLSALSYGADVSSPWQFMRTYALPVMTLCCVIVAQMARMTRAAVIDQLDSPYVEMARL
FT                   KGVSPVRIVLRHALPNAIGPIVNAVALSLSYLLGGVVIVETIFNYPGIASLMVDAVTNR
FT                   DMALVQGCTMLFCSAYLGLVLMADLCAILSNPRLRTQ"
     MNSNTLWLIV QRFGAAIVTL LIVSIVVFAI TAVLPGDAAQ QALGQFATPE QVAALRTQLG        60
     LDQPGVVRYL HWLTNLLGGN LGESVSNAMP VSELIAGRFP KTLMLSATTA LVSVPVALAL       120
     GIGAAMYRGS RLDSALNFIT LSLVAVPEFL VATLAVLIFA VNLGWLSALS YGADVSSPWQ       180
     FMRTYALPVM TLCCVIVAQM ARMTRAAVID QLDSPYVEMA RLKGVSPVRI VLRHALPNAI       240
     GPIVNAVALS LSYLLGGVVI VETIFNYPGI ASLMVDAVTN RDMALVQGCT MLFCSAYLGL       300
     VLMADLCAIL SNPRLRTQ                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page