(data stored in ACNUC7421 zone)

EMBL: CP000075.PE164

CP000075.PE164       Location/Qualifiers
FT   CDS             178366..179082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0164"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35237"
FT                   /db_xref="GOA:Q500D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q500D5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35237.1"
FT                   /translation="MRGGHKVRDHLSVDEEDALARAPLRTSRSASTFHRNVLVALIVVV
FT                   LCGYGLFHYIHQSKTADATPATPATPAMPPAAVAEAPVLAPPPLPQVSTPPQSLAECMG
FT                   PDNLIDEAVADCRFGKSHKTVPRSTAQGMVSAQYMSQYKARQPIRHRNYAMAQFVDSAV
FT                   VWQWDRKRTYRAEWVVDDDQIDGTSVCRNWRRGSIEYRECRKGAKVYFKEQCKRSAESA
FT                   TRQRYCSAASGFNPLG"
     MRGGHKVRDH LSVDEEDALA RAPLRTSRSA STFHRNVLVA LIVVVLCGYG LFHYIHQSKT        60
     ADATPATPAT PAMPPAAVAE APVLAPPPLP QVSTPPQSLA ECMGPDNLID EAVADCRFGK       120
     SHKTVPRSTA QGMVSAQYMS QYKARQPIRH RNYAMAQFVD SAVVWQWDRK RTYRAEWVVD       180
     DDQIDGTSVC RNWRRGSIEY RECRKGAKVY FKEQCKRSAE SATRQRYCSA ASGFNPLG         238
//

If you have problems or comments...

PBIL Back to PBIL home page