(data stored in SCRATCH zone)

EMBL: CP000075.PE167

CP000075.PE167       Location/Qualifiers
FT   CDS             181423..181845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35240"
FT                   /db_xref="GOA:Q500D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q500D2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35240.1"
FT                   /translation="MYFRSFFFFIFMLIALVVYSIAFNLFDNTDCERYNHTEALDGGAK
FT                   SFGSKGFVITVCGAGVNNSLFNGDGMERVRLTIFDNQGELLARRYYKVFWDGQPGHEPL
FT                   KVSKKSIIYQDDKEQKDHVITMPPTRLEWIRARLPL"
     MYFRSFFFFI FMLIALVVYS IAFNLFDNTD CERYNHTEAL DGGAKSFGSK GFVITVCGAG        60
     VNNSLFNGDG MERVRLTIFD NQGELLARRY YKVFWDGQPG HEPLKVSKKS IIYQDDKEQK       120
     DHVITMPPTR LEWIRARLPL                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page