(data stored in ACNUC7421 zone)

EMBL: CP000075.PE172

CP000075.PE172       Location/Qualifiers
FT   CDS             186394..186870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0172"
FT                   /product="Protein of unknown function DUF785"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35245"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:Q500C7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35245.1"
FT                   /translation="MKTFDHLTVIGLREWVALPDLGVAGLRAKIDTGASTSSLHATEIE
FT                   PFERNGQKWVRFNAHLGTVVQLRHRRCEAQLVAMKTIKSSNGQAQVRYVIRTTLALGDR
FT                   IWPVEFTLACRKSMRYRLLLGSKALIDGQLVVNPGITYVQDKPVFPASTSSGVA"
     MKTFDHLTVI GLREWVALPD LGVAGLRAKI DTGASTSSLH ATEIEPFERN GQKWVRFNAH        60
     LGTVVQLRHR RCEAQLVAMK TIKSSNGQAQ VRYVIRTTLA LGDRIWPVEF TLACRKSMRY       120
     RLLLGSKALI DGQLVVNPGI TYVQDKPVFP ASTSSGVA                               158
//

If you have problems or comments...

PBIL Back to PBIL home page