(data stored in ACNUC7421 zone)

EMBL: CP000075.PE173

CP000075.PE173       Location/Qualifiers
FT   CDS             186867..187772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0173"
FT                   /product="SSU ribosomal protein S6P modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35246"
FT                   /db_xref="GOA:Q500C6"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500C6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35246.1"
FT                   /translation="MKIAVLSRNPRLYSTRRLVEAGIERGHEMVVIDTLRAYMNIASHK
FT                   PQIHYRGKPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVFPLNESVAIARSRDKLRSL
FT                   QLLSRRGIGLPVTGFAHSPDDIPDLIQMVNGAPLVIKVLEGTQGIGVVLCETATAAESV
FT                   IEAFMGLKQDIMVQEYIKEAGGADIRCFVVGDKVIASMKRQAKPGEFRSNLHRGGSASL
FT                   IKITPEERMTALRAAKVMGLSVAGVDILRSNHGPLVMEVNSSPGLEGIEVTTSKDVAGM
FT                   IIGYLEKNSGPHMTRTKGKG"
     MKIAVLSRNP RLYSTRRLVE AGIERGHEMV VIDTLRAYMN IASHKPQIHY RGKPLEGFDA        60
     VIPRIGASVT FYGCAVLRQF EMMGVFPLNE SVAIARSRDK LRSLQLLSRR GIGLPVTGFA       120
     HSPDDIPDLI QMVNGAPLVI KVLEGTQGIG VVLCETATAA ESVIEAFMGL KQDIMVQEYI       180
     KEAGGADIRC FVVGDKVIAS MKRQAKPGEF RSNLHRGGSA SLIKITPEER MTALRAAKVM       240
     GLSVAGVDIL RSNHGPLVME VNSSPGLEGI EVTTSKDVAG MIIGYLEKNS GPHMTRTKGK       300
     G                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page