(data stored in ACNUC7421 zone)

EMBL: CP000075.PE175

CP000075.PE175       Location/Qualifiers
FT   CDS             189651..189926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0175"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35248"
FT                   /db_xref="UniProtKB/TrEMBL:Q500C4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35248.1"
FT                   /translation="MTDDIDNDEEDFAASTLIEAIENQIEAGNPPAARAVFNMLTLVNY
FT                   EREDILEMMAHVLAIEIDALLEQDRPFDTQWYEAALRALPDLPPEN"
     MTDDIDNDEE DFAASTLIEA IENQIEAGNP PAARAVFNML TLVNYEREDI LEMMAHVLAI        60
     EIDALLEQDR PFDTQWYEAA LRALPDLPPE N                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page