(data stored in ACNUC7421 zone)

EMBL: CP000075.PE178

CP000075.PE178       Location/Qualifiers
FT   CDS             complement(193552..193959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0178"
FT                   /product="regulator of nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35251"
FT                   /db_xref="GOA:Q500C1"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q500C1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35251.1"
FT                   /translation="MTTAPSIILTRLDVQRLEKFIADQNEDTPGIQALQAELDRADQVV
FT                   GHDEVPAGVVTMNSRVHCREEVSGKDYHLKLVYPQDAGADGTVSVLAPMGSALLGLQIG
FT                   QHIDWPAPGGKTLKLTLLAVEYQPEAAGEYE"
     MTTAPSIILT RLDVQRLEKF IADQNEDTPG IQALQAELDR ADQVVGHDEV PAGVVTMNSR        60
     VHCREEVSGK DYHLKLVYPQ DAGADGTVSV LAPMGSALLG LQIGQHIDWP APGGKTLKLT       120
     LLAVEYQPEA AGEYE                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page