(data stored in ACNUC7421 zone)

EMBL: CP000075.PE185

CP000075.PE185       Location/Qualifiers
FT   CDS             197894..198793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0185"
FT                   /product="tyrosine recombinase XerC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35258"
FT                   /db_xref="GOA:Q500B4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500B4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35258.1"
FT                   /translation="MDQHLDAYCMHLRSERQVSPHTLEAYRRDLGKVLAYCQKAQVSSW
FT                   SDLDIQHLRSFTARQHQQGQSSRSLARMLSAVRGFYKYLNREGICQHDPANGLSPPKGE
FT                   RRLPKTLDTDRAAQLLDGGVEDDFLAHRDQAILELLYSSGLRLSELTGLNLDQLDLRDG
FT                   LVQVLGKGSKTRVLPVGSKARQALEVWLPLRALTNPQDDAVFVSQQGKRLGPRAIQVRL
FT                   KAAGERELGQNLHPHMLRHSFASHLLESSQDLRAVQELLGHADIKTTQIYTHLDFQHLA
FT                   TVYDSAHPRAKRKGTADD"
     MDQHLDAYCM HLRSERQVSP HTLEAYRRDL GKVLAYCQKA QVSSWSDLDI QHLRSFTARQ        60
     HQQGQSSRSL ARMLSAVRGF YKYLNREGIC QHDPANGLSP PKGERRLPKT LDTDRAAQLL       120
     DGGVEDDFLA HRDQAILELL YSSGLRLSEL TGLNLDQLDL RDGLVQVLGK GSKTRVLPVG       180
     SKARQALEVW LPLRALTNPQ DDAVFVSQQG KRLGPRAIQV RLKAAGEREL GQNLHPHMLR       240
     HSFASHLLES SQDLRAVQEL LGHADIKTTQ IYTHLDFQHL ATVYDSAHPR AKRKGTADD        299
//

If you have problems or comments...

PBIL Back to PBIL home page