(data stored in SCRATCH zone)

EMBL: CP000075.PE19

CP000075.PE19        Location/Qualifiers
FT   CDS             complement(23040..23546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0019"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35093"
FT                   /db_xref="GOA:Q500S9"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q500S9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35093.1"
FT                   /translation="MAILNILEFPDSRLRTIAKPVAMVDDGIRQLVDDMFETMYEAPGI
FT                   GLAATQVNVHKRVVVMDLSEDRSEPMVFINPEIEKLTDEMDQYQEGCLSVPGFYENVDR
FT                   PQKVRVKALDRDGKPYELVAEGLLAICIQHECDHLNGKLFVDYLSNLKRDRIKKKLEKQ
FT                   HKLNA"
     MAILNILEFP DSRLRTIAKP VAMVDDGIRQ LVDDMFETMY EAPGIGLAAT QVNVHKRVVV        60
     MDLSEDRSEP MVFINPEIEK LTDEMDQYQE GCLSVPGFYE NVDRPQKVRV KALDRDGKPY       120
     ELVAEGLLAI CIQHECDHLN GKLFVDYLSN LKRDRIKKKL EKQHKLNA                    168
//

If you have problems or comments...

PBIL Back to PBIL home page