(data stored in ACNUC7421 zone)

EMBL: CP000075.PE190

CP000075.PE190       Location/Qualifiers
FT   CDS             complement(202013..202351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0190"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35263"
FT                   /db_xref="GOA:Q500A9"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q500A9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35263.1"
FT                   /translation="MKLVTAIIKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIDVAIDDKDLDRVIEAITKAANTGKIGDGKIFVVNLEQAIRIRT
FT                   GETDTDAI"
     MKLVTAIIKP FKLDDVRESL SEIGVQGITV TEVKGFGRQK GHTELYRGAE YVVDFLPKVK        60
     IDVAIDDKDL DRVIEAITKA ANTGKIGDGK IFVVNLEQAI RIRTGETDTD AI               112
//

If you have problems or comments...

PBIL Back to PBIL home page