(data stored in SCRATCH zone)

EMBL: CP000075.PE191

CP000075.PE191       Location/Qualifiers
FT   CDS             202769..203044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0191"
FT                   /product="Protein of unknown function DUF526"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35264"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q500A8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35264.1"
FT                   /translation="MLAPKAFLDALSGHASRLFNGETPVSRNEFETQFKALLQSGFSKL
FT                   DLVSREEFDSQMAVLARTRARLEALEAKMAELEEKAGGAAGTEKAE"
     MLAPKAFLDA LSGHASRLFN GETPVSRNEF ETQFKALLQS GFSKLDLVSR EEFDSQMAVL        60
     ARTRARLEAL EAKMAELEEK AGGAAGTEKA E                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page