(data stored in ACNUC7421 zone)

EMBL: CP000075.PE192

CP000075.PE192       Location/Qualifiers
FT   CDS             203272..203901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0192"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35265"
FT                   /db_xref="UniProtKB/TrEMBL:Q500A7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35265.1"
FT                   /translation="MDGSMTDKRPLIHCSLAATLWLCVGTSVFAQDTALHSGKYEQLML
FT                   AVTPDHQVEGYYSETRGEAFSCAFYLQGKVEAGKGAAVSSWLDDVYPGTLKASADGVVL
FT                   TIGQGRQHPGCMNVLAPDIATGLDLTRTASRQWVGLVTVTADKAWLQKTPNAKATRGAY
FT                   IVKDDVVGVLAFKDGAAQVELINADDRSFTGWISQDQYARLAAPGR"
     MDGSMTDKRP LIHCSLAATL WLCVGTSVFA QDTALHSGKY EQLMLAVTPD HQVEGYYSET        60
     RGEAFSCAFY LQGKVEAGKG AAVSSWLDDV YPGTLKASAD GVVLTIGQGR QHPGCMNVLA       120
     PDIATGLDLT RTASRQWVGL VTVTADKAWL QKTPNAKATR GAYIVKDDVV GVLAFKDGAA       180
     QVELINADDR SFTGWISQDQ YARLAAPGR                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page