(data stored in ACNUC7421 zone)

EMBL: CP000075.PE196

CP000075.PE196       Location/Qualifiers
FT   CDS             complement(206567..209947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35269"
FT                   /db_xref="GOA:Q500A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q500A3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35269.1"
FT                   /translation="MTDKSGTHTQRRAATFAKTPATATSLCPFRGPDIAIVPVRYALDR
FT                   SRYDAAPEKLKPLLKGSRWAVMPKLKTRSYTLRQLYDGYVYVYDETAGTFHEYFSSAAN
FT                   GHLSRIIWTDAQIGSDRRSGADDGKPFLLYPRNNRLHIAFSAQQWTWRICEHLRSNPAS
FT                   RASWMKALDLKRYCMTMAEPDTLPLNRIAEAVADIDKEHVVDDDRFADSAIPTSKASSE
FT                   EADPLFSPIGADVFWQGSVEDQDSSLLIALDDPLAIFNDLGMQLAADQAAYRNWQAEHE
FT                   HKIQIAQTVTALCGAEGEPEKLPASVRGNAALTHQYLSEVEAYFEQCMFEQEQIGNNTA
FT                   PGGVLLLPDIFKSPQMRRSLEMRYGSAPSDEALQAWKDRHKWRREVDLSGARQYLQQHL
FT                   PTGDTLLQQVQDTQSDFRQWSTHLGTEPLKLFVDTSHPESLLYLQTVMLNLQIIYAQDN
FT                   AASAWLAEQEANDSSLFGTLRYGFSPALKHALHQEANALLNGLGDITNLATRIGELNGT
FT                   LNHQGFADKPWMKALKQPVQDTFKALGQLASDAGKATFESILLAWVPIDSRLAVGKQQN
FT                   IVALIRTLLIGQILLDSKARIAIDHNMLAKLKTWISEWQVLNKQISDTRRSWLYPTAYN
FT                   PRKSIASHLRVLEEKLRLHELSMPALLDFQNNQYARQLQDEIRLHVQSGKAITKEWLTS
FT                   ARRWLDGLGGIAGSITWGVIMLNFINTAFTYRDLTRDGDFSAKDLGKVTYGLGYSFNLL
FT                   MAVFVEAPWAVIRDATPVLIDGKNVGILDRSAGYWRAKGNLVWGDAIRGFRVSMVAMGA
FT                   FGVAAAVLEVLDIQDDLSRVNTSEEIIAMQLKFASVLMMGAGSAIQLIAGIFPTTPLTA
FT                   VAMSPWFSITLLLIGTVYLFATTALNYFKQDSVGWWLRRCCWSRSIEYRYSTDAGGQHA
FT                   EKLDLLTIQLSPQVHVKITTRLESRYLGKGDYYSTAVQDGAGVQLLFPSAVRAQSVHFN
FT                   IISSKRPWGVLPVEKIDSPINESFLNRGQFRQAGQFGTLGNKAARNAHEDFTFPLMPHE
FT                   SEDLIWETWIPLEAEATYLELQIWYPDSLIKPDQQDIGYLYQLKLNREGDTKVDGLITA
FT                   ELEVKALNRSTALTLEVAE"
     MTDKSGTHTQ RRAATFAKTP ATATSLCPFR GPDIAIVPVR YALDRSRYDA APEKLKPLLK        60
     GSRWAVMPKL KTRSYTLRQL YDGYVYVYDE TAGTFHEYFS SAANGHLSRI IWTDAQIGSD       120
     RRSGADDGKP FLLYPRNNRL HIAFSAQQWT WRICEHLRSN PASRASWMKA LDLKRYCMTM       180
     AEPDTLPLNR IAEAVADIDK EHVVDDDRFA DSAIPTSKAS SEEADPLFSP IGADVFWQGS       240
     VEDQDSSLLI ALDDPLAIFN DLGMQLAADQ AAYRNWQAEH EHKIQIAQTV TALCGAEGEP       300
     EKLPASVRGN AALTHQYLSE VEAYFEQCMF EQEQIGNNTA PGGVLLLPDI FKSPQMRRSL       360
     EMRYGSAPSD EALQAWKDRH KWRREVDLSG ARQYLQQHLP TGDTLLQQVQ DTQSDFRQWS       420
     THLGTEPLKL FVDTSHPESL LYLQTVMLNL QIIYAQDNAA SAWLAEQEAN DSSLFGTLRY       480
     GFSPALKHAL HQEANALLNG LGDITNLATR IGELNGTLNH QGFADKPWMK ALKQPVQDTF       540
     KALGQLASDA GKATFESILL AWVPIDSRLA VGKQQNIVAL IRTLLIGQIL LDSKARIAID       600
     HNMLAKLKTW ISEWQVLNKQ ISDTRRSWLY PTAYNPRKSI ASHLRVLEEK LRLHELSMPA       660
     LLDFQNNQYA RQLQDEIRLH VQSGKAITKE WLTSARRWLD GLGGIAGSIT WGVIMLNFIN       720
     TAFTYRDLTR DGDFSAKDLG KVTYGLGYSF NLLMAVFVEA PWAVIRDATP VLIDGKNVGI       780
     LDRSAGYWRA KGNLVWGDAI RGFRVSMVAM GAFGVAAAVL EVLDIQDDLS RVNTSEEIIA       840
     MQLKFASVLM MGAGSAIQLI AGIFPTTPLT AVAMSPWFSI TLLLIGTVYL FATTALNYFK       900
     QDSVGWWLRR CCWSRSIEYR YSTDAGGQHA EKLDLLTIQL SPQVHVKITT RLESRYLGKG       960
     DYYSTAVQDG AGVQLLFPSA VRAQSVHFNI ISSKRPWGVL PVEKIDSPIN ESFLNRGQFR      1020
     QAGQFGTLGN KAARNAHEDF TFPLMPHESE DLIWETWIPL EAEATYLELQ IWYPDSLIKP      1080
     DQQDIGYLYQ LKLNREGDTK VDGLITAELE VKALNRSTAL TLEVAE                     1126
//

If you have problems or comments...

PBIL Back to PBIL home page