(data stored in SCRATCH zone)

EMBL: CP000075.PE197

CP000075.PE197       Location/Qualifiers
FT   CDS             210345..211838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0197"
FT                   /product="Mg chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35270"
FT                   /db_xref="GOA:Q500A2"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q500A2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35270.1"
FT                   /translation="MSLAIVHSRAQVGVEAPAVTVEAHLANGLPALTLVGLPEGAVKES
FT                   KDRVRSAILNSGLDFPARRITLNLAPADLPKDGGRFDLAIALGLLAASGQVPLVALQDV
FT                   ECLGELALSGAIRPIQGVLPAALAARAAERTLIIPAVNAEEACLASGLRVIAVSHLLEL
FT                   VAHFNGRTVIAPYQSSGLLHQPKPYPDLSEVQGQTAAKRALVIAAAGAHNLLFSGPPGT
FT                   GKTLLASRLPGLLPPLDEHEALEVAAIQSVASQVPLTSWPQRPFRQPHHSASGPALVGG
FT                   GSRPQPGEITLAHHGVLFLDELPEFDRRVLEVLREPLESGHIVISRARDRVRFPARFQL
FT                   VAAMNPCPCGYLGEPTGRCRCSTEQVQRYRNKLSGPLLDRIDLHLTVAREATALNPDPT
FT                   TSENTASAAAVVAEARDRQQRRQGCANAFLDLPGLREYCALSSVDESWLETACERLTLS
FT                   LRSAHRLLKVARTLADLEQVDAINRSHLAEALQYRPSTN"
     MSLAIVHSRA QVGVEAPAVT VEAHLANGLP ALTLVGLPEG AVKESKDRVR SAILNSGLDF        60
     PARRITLNLA PADLPKDGGR FDLAIALGLL AASGQVPLVA LQDVECLGEL ALSGAIRPIQ       120
     GVLPAALAAR AAERTLIIPA VNAEEACLAS GLRVIAVSHL LELVAHFNGR TVIAPYQSSG       180
     LLHQPKPYPD LSEVQGQTAA KRALVIAAAG AHNLLFSGPP GTGKTLLASR LPGLLPPLDE       240
     HEALEVAAIQ SVASQVPLTS WPQRPFRQPH HSASGPALVG GGSRPQPGEI TLAHHGVLFL       300
     DELPEFDRRV LEVLREPLES GHIVISRARD RVRFPARFQL VAAMNPCPCG YLGEPTGRCR       360
     CSTEQVQRYR NKLSGPLLDR IDLHLTVARE ATALNPDPTT SENTASAAAV VAEARDRQQR       420
     RQGCANAFLD LPGLREYCAL SSVDESWLET ACERLTLSLR SAHRLLKVAR TLADLEQVDA       480
     INRSHLAEAL QYRPSTN                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page