(data stored in ACNUC7421 zone)

EMBL: CP000075.PE2

CP000075.PE2         Location/Qualifiers
FT   CDS             1575..2678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35076"
FT                   /db_xref="GOA:Q500U6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q500U6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35076.1"
FT                   /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLT
FT                   GTDLEVELVGRVQLEEPAEPGEITVPARKLMDICKSLSNDALIDIKLDDSKLIVKAGRS
FT                   RFTLSTLPANDFPTVEEGPGSLTFTLVQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVS
FT                   AGILRAVATDGHRLAMCSMSADIEHADRHQVIVPRKGILEMARLLTEQDGTVSIVLGQH
FT                   HIRATTGEFTFTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSRTAILSNEKYRG
FT                   IRLQLASGQLKIQANNPEQEEAEEEISVEYNGDSLEIGFNVSYLLDVLGVMTTEQVRLI
FT                   LSDSNSSALVQESDNDDSAYVVMPMRL"
     MHFTIQREAL LKPLQLVAGV VERRQTLPVL SNVLLVVEGQ QLSLTGTDLE VELVGRVQLE        60
     EPAEPGEITV PARKLMDICK SLSNDALIDI KLDDSKLIVK AGRSRFTLST LPANDFPTVE       120
     EGPGSLTFTL VQSKLRRLIE RTSFAMAQQD VRYYLNGMLL EVSAGILRAV ATDGHRLAMC       180
     SMSADIEHAD RHQVIVPRKG ILEMARLLTE QDGTVSIVLG QHHIRATTGE FTFTSKLVDG       240
     KFPDYERVLP KGGDKLVLGD RQALREAFSR TAILSNEKYR GIRLQLASGQ LKIQANNPEQ       300
     EEAEEEISVE YNGDSLEIGF NVSYLLDVLG VMTTEQVRLI LSDSNSSALV QESDNDDSAY       360
     VVMPMRL                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page