(data stored in ACNUC7421 zone)

EMBL: CP000075.PE204

CP000075.PE204       Location/Qualifiers
FT   CDS             complement(219306..219731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0204"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35277"
FT                   /db_xref="GOA:Q4ZZZ5"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014170"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35277.1"
FT                   /translation="MGLHLNEGGDDLAENHEINVTPFIDVMLVLLIIFMVAAPLATVDI
FT                   KVDLPASTATPQPRPEKPIFLSVKTDKSLYLGEEKVAREQIGQVLDARTKGKKDTTIFF
FT                   QADKGVDYGDLMEVMNTLRGAGYLKVGLVGLETAGKK"
     MGLHLNEGGD DLAENHEINV TPFIDVMLVL LIIFMVAAPL ATVDIKVDLP ASTATPQPRP        60
     EKPIFLSVKT DKSLYLGEEK VAREQIGQVL DARTKGKKDT TIFFQADKGV DYGDLMEVMN       120
     TLRGAGYLKV GLVGLETAGK K                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page