(data stored in SCRATCH zone)

EMBL: CP000075.PE21

CP000075.PE21        Location/Qualifiers
FT   CDS             24821..25939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0021"
FT                   /product="DNA protecting protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35095"
FT                   /db_xref="GOA:Q500S7"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q500S7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35095.1"
FT                   /translation="MPLFENAPSSPAELEARLRMHRLPEIGPKRFSRLIEAFGSASSAL
FT                   SAPASAWRALGIPGACAEARRDPSVRDGASAALAWLERPAQHLLMWDDPGYPALLAQIA
FT                   DPPPLIFIAGDPSILERPQLGMVGSRRASRPGLDTASAFARSLAAAGFVITSGLARGID
FT                   GAAHQGALDVGGLTIGVLGTGLEKLYPQQHRALAAQIAAQGGAVISEFPLDAAAQASNF
FT                   PRRNRIISGLSLGILVVEASVASGSLITARLAAEHGREVYAIPGSIHHPGAKGCHQLIR
FT                   DGATLVETVEHILEGLQHWKRVTPDIDPVTPAKPVPCDHPLLALLHAAPHTSEGLSVSC
FT                   GWPLPKVLAGLTELELDGRISCEAGRWFARAP"
     MPLFENAPSS PAELEARLRM HRLPEIGPKR FSRLIEAFGS ASSALSAPAS AWRALGIPGA        60
     CAEARRDPSV RDGASAALAW LERPAQHLLM WDDPGYPALL AQIADPPPLI FIAGDPSILE       120
     RPQLGMVGSR RASRPGLDTA SAFARSLAAA GFVITSGLAR GIDGAAHQGA LDVGGLTIGV       180
     LGTGLEKLYP QQHRALAAQI AAQGGAVISE FPLDAAAQAS NFPRRNRIIS GLSLGILVVE       240
     ASVASGSLIT ARLAAEHGRE VYAIPGSIHH PGAKGCHQLI RDGATLVETV EHILEGLQHW       300
     KRVTPDIDPV TPAKPVPCDH PLLALLHAAP HTSEGLSVSC GWPLPKVLAG LTELELDGRI       360
     SCEAGRWFAR AP                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page