(data stored in ACNUC7421 zone)

EMBL: CP000075.PE212

CP000075.PE212       Location/Qualifiers
FT   CDS             complement(226239..227102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0212"
FT                   /product="Conserved hypothetical protein 255"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35285"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35285.1"
FT                   /translation="MVHSMTAFARVERAGAQGTLSWELRSVNHRYLEPHLRLPESFRDL
FT                   EGAIREALRQGLSRGKVECTLRFVEETAGKPLQVDLERAGQLVAAAESVAGLIKQPAAL
FT                   NPLEVLAWPGVLVADANDPQVLNTEALKLFNDALTELKSGRGREGADLARLLDERLSSI
FT                   VEEVATLRTLVPQMLATQRQKVLDRFADMKAELDPQRLEQEMVLLAQKSDVAEELDRLS
FT                   THVTEVRRVLKAGGQAGRRLDFLMQELNREANTLGSKAFDPRSTQAAVNLKVLIEQMRE
FT                   QVQNIE"
     MVHSMTAFAR VERAGAQGTL SWELRSVNHR YLEPHLRLPE SFRDLEGAIR EALRQGLSRG        60
     KVECTLRFVE ETAGKPLQVD LERAGQLVAA AESVAGLIKQ PAALNPLEVL AWPGVLVADA       120
     NDPQVLNTEA LKLFNDALTE LKSGRGREGA DLARLLDERL SSIVEEVATL RTLVPQMLAT       180
     QRQKVLDRFA DMKAELDPQR LEQEMVLLAQ KSDVAEELDR LSTHVTEVRR VLKAGGQAGR       240
     RLDFLMQELN REANTLGSKA FDPRSTQAAV NLKVLIEQMR EQVQNIE                     287
//

If you have problems or comments...

PBIL Back to PBIL home page