(data stored in ACNUC7421 zone)

EMBL: CP000075.PE218

CP000075.PE218       Location/Qualifiers
FT   CDS             complement(231075..231980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0218"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35291"
FT                   /db_xref="GOA:Q4ZZY1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35291.1"
FT                   /translation="MTLERDAASNVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELK
FT                   TGFARDIVLMKAVGINPVVVHGGGPQIGDLLKRLSIESHFIDGMRVTDAQTMDVVEMVL
FT                   GGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVTRQTPEMTKPEIIDIGQVGEVV
FT                   GVNTGLLNMLVKGDFIPVIAPIGVGPDGESYNINADLVAGKVAEALKAEKLILLTNIAG
FT                   LMNKQGEVLTGLTTEQVDGLIADGTIYGGMLPKIRCALEAVQGGVNSSHIIDGRVPNAV
FT                   LLEIFTDSGVGTQITNRKRH"
     MTLERDAASN VAKVLSEALP YIRRFVGKTL VIKYGGNAME SEELKTGFAR DIVLMKAVGI        60
     NPVVVHGGGP QIGDLLKRLS IESHFIDGMR VTDAQTMDVV EMVLGGQVNK DIVNLINRHG       120
     GSAIGLTGKD AELIRAKKLT VTRQTPEMTK PEIIDIGQVG EVVGVNTGLL NMLVKGDFIP       180
     VIAPIGVGPD GESYNINADL VAGKVAEALK AEKLILLTNI AGLMNKQGEV LTGLTTEQVD       240
     GLIADGTIYG GMLPKIRCAL EAVQGGVNSS HIIDGRVPNA VLLEIFTDSG VGTQITNRKR       300
     H                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page