(data stored in SCRATCH zone)

EMBL: CP000075.PE222

CP000075.PE222       Location/Qualifiers
FT   CDS             236452..237126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0222"
FT                   /product="DNA replication and repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35295"
FT                   /db_xref="GOA:Q4ZZX7"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35295.1"
FT                   /translation="MSIRSWPAAERPRERLLELGAASLSDAELLAIFLRTGVAGKSAVD
FT                   LARHLLNQFDGLRPLLDADLSAFTSQLGLGPAKFAQLQAVMEMARRHMAESLRRESALE
FT                   NPTQVRSYLKALLRHEPHEVFGCLFLDNKHRVMTFEILFRGTINASYVHPRQVVKRAMA
FT                   HNAASLILCHNHPSGITTPSRSDIDLTKRLKEALLLVDVHVLDHVIVGDGEPLSMVERG
FT                   LM"
     MSIRSWPAAE RPRERLLELG AASLSDAELL AIFLRTGVAG KSAVDLARHL LNQFDGLRPL        60
     LDADLSAFTS QLGLGPAKFA QLQAVMEMAR RHMAESLRRE SALENPTQVR SYLKALLRHE       120
     PHEVFGCLFL DNKHRVMTFE ILFRGTINAS YVHPRQVVKR AMAHNAASLI LCHNHPSGIT       180
     TPSRSDIDLT KRLKEALLLV DVHVLDHVIV GDGEPLSMVE RGLM                        224
//

If you have problems or comments...

PBIL Back to PBIL home page