(data stored in ACNUC7421 zone)

EMBL: CP000075.PE223

CP000075.PE223       Location/Qualifiers
FT   CDS             complement(237260..238846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0223"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35296"
FT                   /db_xref="GOA:Q4ZZX6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35296.1"
FT                   /translation="MRLAALPFLLVPLLLPVAAQASNLVVCTEASPEGFDVVQYNSLTT
FT                   TNASADVLMNRLVDFDAKSGKLVPSLADSWTVSKDGLTYDFKLHPGVKFHTTDYFKPTR
FT                   ELSADDVLFSFQRMLDPQNPWHKIAQSGFPHAQSMQLPALIKSIEAPDAHTVRFTLNHA
FT                   DSTFLATLSMGFASIYSAEYTAQLLKAGTPEKLNSQPIGTGPFVFKRFQKDAVVRYEAF
FT                   DDYFAGKSDIDTLVYAITPDANVRLQKIRQDECQIALSPKPLDIQAASKDDSLKVEKTE
FT                   AFMTAFVAINSQHPPFDKPEVRQAINLAFDRDNYLKAVFEGTAEKANGPYPPNTWSYAK
FT                   DLPGYQHDVAKAKALLAKAGVKEGFKTTIWTRPSGSLLNPNPSLGAQLLQADLKQIGIN
FT                   AEIKIIEWGELIRRAKAGEHDLLFMGWAGDNGDPDNFLTPQFSCAAVQSGTNFARYCDK
FT                   TLDKLIADGKSVSDQGERSKLYHQAQQQIQQQALWIPLAHPTAAALVRKDVTGYQVSPF
FT                   GRQDFYKVQVK"
     MRLAALPFLL VPLLLPVAAQ ASNLVVCTEA SPEGFDVVQY NSLTTTNASA DVLMNRLVDF        60
     DAKSGKLVPS LADSWTVSKD GLTYDFKLHP GVKFHTTDYF KPTRELSADD VLFSFQRMLD       120
     PQNPWHKIAQ SGFPHAQSMQ LPALIKSIEA PDAHTVRFTL NHADSTFLAT LSMGFASIYS       180
     AEYTAQLLKA GTPEKLNSQP IGTGPFVFKR FQKDAVVRYE AFDDYFAGKS DIDTLVYAIT       240
     PDANVRLQKI RQDECQIALS PKPLDIQAAS KDDSLKVEKT EAFMTAFVAI NSQHPPFDKP       300
     EVRQAINLAF DRDNYLKAVF EGTAEKANGP YPPNTWSYAK DLPGYQHDVA KAKALLAKAG       360
     VKEGFKTTIW TRPSGSLLNP NPSLGAQLLQ ADLKQIGINA EIKIIEWGEL IRRAKAGEHD       420
     LLFMGWAGDN GDPDNFLTPQ FSCAAVQSGT NFARYCDKTL DKLIADGKSV SDQGERSKLY       480
     HQAQQQIQQQ ALWIPLAHPT AAALVRKDVT GYQVSPFGRQ DFYKVQVK                    528
//

If you have problems or comments...

PBIL Back to PBIL home page