(data stored in ACNUC7421 zone)

EMBL: CP000075.PE231

CP000075.PE231       Location/Qualifiers
FT   CDS             246432..246683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0231"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35304"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35304.1"
FT                   /translation="MNGFSDVRLALHSQELNEYRPATVRTVRSNKADLLAGMGRWALYR
FT                   HRWASRRSLLTLTDDQLRDIGLDFRQARVEAMKPFWRP"
     MNGFSDVRLA LHSQELNEYR PATVRTVRSN KADLLAGMGR WALYRHRWAS RRSLLTLTDD        60
     QLRDIGLDFR QARVEAMKPF WRP                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page