(data stored in ACNUC7421 zone)

EMBL: CP000075.PE235

CP000075.PE235       Location/Qualifiers
FT   CDS             249112..250413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0235"
FT                   /product="D-amino acid dehydrogenase small subunit"
FT                   /EC_number="1.4.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35308"
FT                   /db_xref="GOA:Q4ZZW4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023080"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35308.1"
FT                   /translation="MRVLVLGSGVIGTTSAYYLARAGFQVTVVDRQPAAAMETSFANAG
FT                   QVSPGYASPWAAPGVPLKALKWLLQRHAPLAIKATADIDQYLWMAQMLRNCTASRYAIN
FT                   KERMVRLSEYSRDCLDELRLETGIAYEGRSLGTTQLFRTQAQLDNAAKDIAVLEQSGVP
FT                   YELLDRDGIARVEPALAGVTGILSGALRLPNDQTGDCQLFTTRLAEMAVALGVEFRYGQ
FT                   NIERLDHAGDRINGVWIDGKLETADRYVLALGSYSPQLLKPLGIKAPVYPLKGYSLTVP
FT                   ITNPDMAPTSTILDETYKVAITRFDNRIRVGGMAEIAGFDLSLNPRRRETLEMIVGDLY
FT                   PQGGDLTQADFWTGLRPTTPDGTPIVGATPFRNLFLNTGHGTLGWTMACGSGRLLADLI
FT                   ARKTPRISAEGLDISRYGNTQENAQHVHPAPAHQ"
     MRVLVLGSGV IGTTSAYYLA RAGFQVTVVD RQPAAAMETS FANAGQVSPG YASPWAAPGV        60
     PLKALKWLLQ RHAPLAIKAT ADIDQYLWMA QMLRNCTASR YAINKERMVR LSEYSRDCLD       120
     ELRLETGIAY EGRSLGTTQL FRTQAQLDNA AKDIAVLEQS GVPYELLDRD GIARVEPALA       180
     GVTGILSGAL RLPNDQTGDC QLFTTRLAEM AVALGVEFRY GQNIERLDHA GDRINGVWID       240
     GKLETADRYV LALGSYSPQL LKPLGIKAPV YPLKGYSLTV PITNPDMAPT STILDETYKV       300
     AITRFDNRIR VGGMAEIAGF DLSLNPRRRE TLEMIVGDLY PQGGDLTQAD FWTGLRPTTP       360
     DGTPIVGATP FRNLFLNTGH GTLGWTMACG SGRLLADLIA RKTPRISAEG LDISRYGNTQ       420
     ENAQHVHPAP AHQ                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page