(data stored in ACNUC7421 zone)

EMBL: CP000075.PE240

CP000075.PE240       Location/Qualifiers
FT   CDS             252906..253160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35313"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35313.1"
FT                   /translation="MRCTLVPVPERPALCMRFMGASRATLRLLAKMMFRSMHFGDSTHP
FT                   FREQVRSYALWAEARKPFVPGVSGIVYNDNALRDEHAAL"
     MRCTLVPVPE RPALCMRFMG ASRATLRLLA KMMFRSMHFG DSTHPFREQV RSYALWAEAR        60
     KPFVPGVSGI VYNDNALRDE HAAL                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page