(data stored in ACNUC7421 zone)

EMBL: CP000075.PE244

CP000075.PE244       Location/Qualifiers
FT   CDS             256622..257623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0244"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35317"
FT                   /db_xref="GOA:Q4ZZV5"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35317.1"
FT                   /translation="MQASKRLLAALTLTLLGSTAQAADEVVVYSSRIDELIKPVFDAYT
FT                   ASTGVKIKFITDKEAPLMQRIKAEGENATADLLLTVDAGNLWQAERMGILQPFTSPVIE
FT                   ANILPQYRSSSHGWTGLSLRARTIAYSTDRVKPAELSTYEALADKNWEGRLCLRTAKKV
FT                   YNQSLTATLIETHGAEASEKILKGWVNNLSTDVFSDDIAVLEAINAGQCDVGIVNSYYY
FT                   GRLHKEKPGLAVKLFWPNQADRGVHVNLSGIGLTKYAPHPEAAKSLVEWMTGPEAQKIF
FT                   SSVNQEFPANPNVAPSEEVASWGPFKADTLPVEVAGKRQAEAIRMMDRAGWN"
     MQASKRLLAA LTLTLLGSTA QAADEVVVYS SRIDELIKPV FDAYTASTGV KIKFITDKEA        60
     PLMQRIKAEG ENATADLLLT VDAGNLWQAE RMGILQPFTS PVIEANILPQ YRSSSHGWTG       120
     LSLRARTIAY STDRVKPAEL STYEALADKN WEGRLCLRTA KKVYNQSLTA TLIETHGAEA       180
     SEKILKGWVN NLSTDVFSDD IAVLEAINAG QCDVGIVNSY YYGRLHKEKP GLAVKLFWPN       240
     QADRGVHVNL SGIGLTKYAP HPEAAKSLVE WMTGPEAQKI FSSVNQEFPA NPNVAPSEEV       300
     ASWGPFKADT LPVEVAGKRQ AEAIRMMDRA GWN                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page