(data stored in ACNUC7421 zone)

EMBL: CP000075.PE249

CP000075.PE249       Location/Qualifiers
FT   CDS             complement(261709..263493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0249"
FT                   /product="type II secretion system protein E:General
FT                   secretory system II, protein E, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35322"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35322.1"
FT                   /translation="MAALAPSSQDRWLDLNDVLRDLVAEGYLGQDDAETALTQRRSAVN
FT                   IQLHPLEFLASLQFDDFKRPGKKLDVETLTAWLAKACGQPYMRIDPLKINVAAVTPLMS
FT                   YAFAQRHKILAVAVDRESVTIASAQPYVRSWEADLAHVLKLQIKRVVANPADIQRMAME
FT                   FFRLAKSVSGASASEQKMSNMGNFEQLLKLGASDQEPDANDAHIVNIVDWLFQYAFQQR
FT                   ASDIHIEPRREQGTVRFRIDGVLHNVYQFPAQVIMAIVSRLKSLGRMNVAEKRKPQDGR
FT                   VKTTTPENREVELRLSTLPTAFGEKMVMRIFDPEVLLKDFDQLGFSSDDLRRWQEMTRQ
FT                   PNGIILVTGPTGSGKTTTLYTTLKKLATSEVNLCTIEDPIEMVEPAFNQMQVQHNIDLS
FT                   FAAGVRALMRQDPDIIMIGEIRDLETAEMAIQAALTGHLVLSTLHTNDAPSAISRMLEL
FT                   GVPHYLLKATILGVMAQRLVRTLCPHCKAPINLNETDWQTLTRPWQAPVPPGAHQAVGC
FT                   VECRDTGYRGRAGVYEIMVMSDNIKALISADLDLTAMRRQAFKEGTRSLRLSGAQKVSA
FT                   GLTTLEEVLRVTPQSEQR"
     MAALAPSSQD RWLDLNDVLR DLVAEGYLGQ DDAETALTQR RSAVNIQLHP LEFLASLQFD        60
     DFKRPGKKLD VETLTAWLAK ACGQPYMRID PLKINVAAVT PLMSYAFAQR HKILAVAVDR       120
     ESVTIASAQP YVRSWEADLA HVLKLQIKRV VANPADIQRM AMEFFRLAKS VSGASASEQK       180
     MSNMGNFEQL LKLGASDQEP DANDAHIVNI VDWLFQYAFQ QRASDIHIEP RREQGTVRFR       240
     IDGVLHNVYQ FPAQVIMAIV SRLKSLGRMN VAEKRKPQDG RVKTTTPENR EVELRLSTLP       300
     TAFGEKMVMR IFDPEVLLKD FDQLGFSSDD LRRWQEMTRQ PNGIILVTGP TGSGKTTTLY       360
     TTLKKLATSE VNLCTIEDPI EMVEPAFNQM QVQHNIDLSF AAGVRALMRQ DPDIIMIGEI       420
     RDLETAEMAI QAALTGHLVL STLHTNDAPS AISRMLELGV PHYLLKATIL GVMAQRLVRT       480
     LCPHCKAPIN LNETDWQTLT RPWQAPVPPG AHQAVGCVEC RDTGYRGRAG VYEIMVMSDN       540
     IKALISADLD LTAMRRQAFK EGTRSLRLSG AQKVSAGLTT LEEVLRVTPQ SEQR             594
//

If you have problems or comments...

PBIL Back to PBIL home page