(data stored in ACNUC7421 zone)

EMBL: CP000075.PE256

CP000075.PE256       Location/Qualifiers
FT   CDS             complement(271132..271515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0256"
FT                   /product="Phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35329"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35329.1"
FT                   /translation="MDIPEDLTHSAYFKMLGCELRRLDEGVAEVALPLEAHLRNRGNVM
FT                   HGGAIFSLVDIAMGLACSSVHGFDQRSVTIECKINYVRGVSEGEVLCIARVLHAGRRTL
FT                   VVEAEVVQGDKLVAKAQGTFAVI"
     MDIPEDLTHS AYFKMLGCEL RRLDEGVAEV ALPLEAHLRN RGNVMHGGAI FSLVDIAMGL        60
     ACSSVHGFDQ RSVTIECKIN YVRGVSEGEV LCIARVLHAG RRTLVVEAEV VQGDKLVAKA       120
     QGTFAVI                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page