(data stored in ACNUC7421 zone)

EMBL: CP000075.PE259

CP000075.PE259       Location/Qualifiers
FT   CDS             275025..276347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0259"
FT                   /product="Osmolarity sensor protein envZ"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35332"
FT                   /db_xref="GOA:Q4ZZU0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZU0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35332.1"
FT                   /translation="MAAVMKTPLWFPQSFFSRTLWLVLIVVLFSKALTLVYLLMNEDVL
FT                   VDRQYSHGVALTLRAYWAAGENDREAIAEAAGLIRVVGGGVPEGEQHWPYSEIYQRQMQ
FT                   AELGADTEVRLRVHAPPALWVRAPSLGDGWLKVPLYPHPLRGQKIWNVLGWFLAIGLLS
FT                   TASAWIFVRQLNQPLKRLVFAARQLGQGRSVRLPVSDTPSEMTEVYRAFNQMAEDVEQA
FT                   GQERELMLAGVSHDLRTPLTRLRLSLELMNDNEFSEGMVRDIEDMDAILDQFLAFIRDG
FT                   RDEEIEEVDLGHLVRDVVAPFNDDEDSIRLCLEPIPPFPLRRVSMKRLLTNLIGNAKHH
FT                   AGNGIEVAAYVSGDRNAPYVVLSVLDRGAGIDPSELDTIFNPFIRGDRARSGKGTGLGL
FT                   AIVKRIAAMHGGNVELRNRSGGGLEARVRLPLGLMLPRDAI"
     MAAVMKTPLW FPQSFFSRTL WLVLIVVLFS KALTLVYLLM NEDVLVDRQY SHGVALTLRA        60
     YWAAGENDRE AIAEAAGLIR VVGGGVPEGE QHWPYSEIYQ RQMQAELGAD TEVRLRVHAP       120
     PALWVRAPSL GDGWLKVPLY PHPLRGQKIW NVLGWFLAIG LLSTASAWIF VRQLNQPLKR       180
     LVFAARQLGQ GRSVRLPVSD TPSEMTEVYR AFNQMAEDVE QAGQERELML AGVSHDLRTP       240
     LTRLRLSLEL MNDNEFSEGM VRDIEDMDAI LDQFLAFIRD GRDEEIEEVD LGHLVRDVVA       300
     PFNDDEDSIR LCLEPIPPFP LRRVSMKRLL TNLIGNAKHH AGNGIEVAAY VSGDRNAPYV       360
     VLSVLDRGAG IDPSELDTIF NPFIRGDRAR SGKGTGLGLA IVKRIAAMHG GNVELRNRSG       420
     GGLEARVRLP LGLMLPRDAI                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page