(data stored in ACNUC7421 zone)

EMBL: CP000075.PE260

CP000075.PE260       Location/Qualifiers
FT   CDS             complement(276603..277070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35333"
FT                   /db_xref="GOA:Q4ZZT9"
FT                   /db_xref="InterPro:IPR014453"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35333.1"
FT                   /translation="MHTSFRTLAAALLMGGSAMVMAANDGQSRVNELLSSAPEYRTTWA
FT                   KVVKKEERLPDWVINLSGASGQQMTAATEDGDNYLVGPLCETADTCKSKRLIVAFSLDK
FT                   EDAYAMLVEVPAGLPADKSPTRHATYRYLGKPDEGMQKLLNEELRKDPNWY"
     MHTSFRTLAA ALLMGGSAMV MAANDGQSRV NELLSSAPEY RTTWAKVVKK EERLPDWVIN        60
     LSGASGQQMT AATEDGDNYL VGPLCETADT CKSKRLIVAF SLDKEDAYAM LVEVPAGLPA       120
     DKSPTRHATY RYLGKPDEGM QKLLNEELRK DPNWY                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page