(data stored in ACNUC7421 zone)

EMBL: CP000075.PE261

CP000075.PE261       Location/Qualifiers
FT   CDS             complement(277295..277582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35334"
FT                   /db_xref="GOA:Q4ZZT8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35334.1"
FT                   /translation="MNSQRIAQLRISPLHIQQGLFLLLALLVTLIAIQQFQRWNQANEA
FT                   AQPKQQFIQTSSISYRGVSAPAVKDMSSSLRNVDGLVSVDEVAPQQKWVF"
     MNSQRIAQLR ISPLHIQQGL FLLLALLVTL IAIQQFQRWN QANEAAQPKQ QFIQTSSISY        60
     RGVSAPAVKD MSSSLRNVDG LVSVDEVAPQ QKWVF                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page