(data stored in ACNUC7421 zone)

EMBL: CP000075.PE27

CP000075.PE27        Location/Qualifiers
FT   CDS             complement(31284..31601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35101"
FT                   /db_xref="UniProtKB/TrEMBL:Q500S1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35101.1"
FT                   /translation="MKRSLIPLSLALILSASFASAGSWPPETSAKVPGNALEYPTKLEA
FT                   VNVSMEEMLNAGATVVSSYVADIGPVVTLKNKKHYVICMLRGAGTGSDTNVATSKCYAM
FT                   N"
     MKRSLIPLSL ALILSASFAS AGSWPPETSA KVPGNALEYP TKLEAVNVSM EEMLNAGATV        60
     VSSYVADIGP VVTLKNKKHY VICMLRGAGT GSDTNVATSK CYAMN                       105
//

If you have problems or comments...

PBIL Back to PBIL home page