(data stored in ACNUC7421 zone)

EMBL: CP000075.PE271

CP000075.PE271       Location/Qualifiers
FT   CDS             290530..290817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35344"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35344.1"
FT                   /translation="MCKVNRLILTGLLAFCPLLAVAAEDPPSAAPDVTIRTDGDRTIQE
FT                   YRQNGFLYAVKITPKHGKPYFLVRADGTSPNFIRSDQPDMLIPQWEIFSW"
     MCKVNRLILT GLLAFCPLLA VAAEDPPSAA PDVTIRTDGD RTIQEYRQNG FLYAVKITPK        60
     HGKPYFLVRA DGTSPNFIRS DQPDMLIPQW EIFSW                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page