(data stored in ACNUC7421 zone)

EMBL: CP000075.PE272

CP000075.PE272       Location/Qualifiers
FT   CDS             290854..291804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0272"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35345"
FT                   /db_xref="GOA:Q4ZZS7"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35345.1"
FT                   /translation="MSVFTPLARPELETFLAPYGLGRLLDYQGIAAGSENTNYFISLEQ
FT                   GEFVLTLVERGPVQEMPFFIELLDVLHEADLPVPYALRTTDGQALRELADKPALLQPRL
FT                   PGKHISEPNTQHCVQIGELLANLHLATRGQIVERKTDRGLDWMLSEGRNFLSHLGETQR
FT                   ALLEKSLQEIEACKPQIMALPRANLHADLFRDNVLFEGTHLTGLIDFYNACSGPMLYDL
FT                   AITLNDWCSRENGQLDAVRARALLGAYAGLRPFTAAESKLWATMLRIACVRFWLSRLIA
FT                   AETFAGQDVLIHDPAEFERRLAERQEAHIALPFAL"
     MSVFTPLARP ELETFLAPYG LGRLLDYQGI AAGSENTNYF ISLEQGEFVL TLVERGPVQE        60
     MPFFIELLDV LHEADLPVPY ALRTTDGQAL RELADKPALL QPRLPGKHIS EPNTQHCVQI       120
     GELLANLHLA TRGQIVERKT DRGLDWMLSE GRNFLSHLGE TQRALLEKSL QEIEACKPQI       180
     MALPRANLHA DLFRDNVLFE GTHLTGLIDF YNACSGPMLY DLAITLNDWC SRENGQLDAV       240
     RARALLGAYA GLRPFTAAES KLWATMLRIA CVRFWLSRLI AAETFAGQDV LIHDPAEFER       300
     RLAERQEAHI ALPFAL                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page