(data stored in SCRATCH zone)

EMBL: CP000075.PE275

CP000075.PE275       Location/Qualifiers
FT   CDS             complement(293509..294450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0275"
FT                   /product="Periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35348"
FT                   /db_xref="GOA:Q4ZZS4"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR035520"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZS4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35348.1"
FT                   /translation="MRRLLNLAAVFWVSLLIISPAQAEVRVLTSIKPLQLIAAAVQDGV
FT                   GTPEVLLPPGASPHNYALRPSDVRRVQEVELLYWIGPDMETFLPRVIQGRKLPAVAVQT
FT                   LPGMHLRHFGEDNASHDDHEHDHDNDADEHDHDHRPGSLDSHLWLSTVNARVIAAKMAT
FT                   DLSAADPANAARYASNAEAFSKRLDTLDARIKQRVSTVAGKPYFVFHEAFDYFEEAYGL
FT                   KHAGVFAIAAEIQPGAQHVAAMRERLKAAGKTCVFSEPPLRPRLAETLSAGLPVKLAEL
FT                   DALGGYTPATAQGYEQVLQKLADDLAGCLSSL"
     MRRLLNLAAV FWVSLLIISP AQAEVRVLTS IKPLQLIAAA VQDGVGTPEV LLPPGASPHN        60
     YALRPSDVRR VQEVELLYWI GPDMETFLPR VIQGRKLPAV AVQTLPGMHL RHFGEDNASH       120
     DDHEHDHDND ADEHDHDHRP GSLDSHLWLS TVNARVIAAK MATDLSAADP ANAARYASNA       180
     EAFSKRLDTL DARIKQRVST VAGKPYFVFH EAFDYFEEAY GLKHAGVFAI AAEIQPGAQH       240
     VAAMRERLKA AGKTCVFSEP PLRPRLAETL SAGLPVKLAE LDALGGYTPA TAQGYEQVLQ       300
     KLADDLAGCL SSL                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page