(data stored in SCRATCH zone)

EMBL: CP000075.PE282

CP000075.PE282       Location/Qualifiers
FT   CDS             300942..301616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0282"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35355"
FT                   /db_xref="GOA:Q4ZZR7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZR7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35355.1"
FT                   /translation="MDAFLNLFSNVDWYEIWVATGDTLIMLGVSLGFTILLGLPLGVLM
FT                   FLTSPRQLLEHKQLYATVGVIVNMLRALPFIILLIVMMPLTEIITGTSLGILGTLPPLI
FT                   AGATPFFARLVETALREVDRGIIEATQAMGATTRQIIVKALLPEARPGILAAITVTAIA
FT                   LVSFTAMAGAVGAGGLGDLAIRYGYQRFQNDVMFVTVVLLLVLVQILQTIGDRLVAHFT
FT                   HR"
     MDAFLNLFSN VDWYEIWVAT GDTLIMLGVS LGFTILLGLP LGVLMFLTSP RQLLEHKQLY        60
     ATVGVIVNML RALPFIILLI VMMPLTEIIT GTSLGILGTL PPLIAGATPF FARLVETALR       120
     EVDRGIIEAT QAMGATTRQI IVKALLPEAR PGILAAITVT AIALVSFTAM AGAVGAGGLG       180
     DLAIRYGYQR FQNDVMFVTV VLLLVLVQIL QTIGDRLVAH FTHR                        224
//

If you have problems or comments...

PBIL Back to PBIL home page