(data stored in SCRATCH zone)

EMBL: CP000075.PE284

CP000075.PE284       Location/Qualifiers
FT   CDS             complement(302686..303318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0284"
FT                   /product="Electron transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35357"
FT                   /db_xref="GOA:Q4ZZR5"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZR5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35357.1"
FT                   /translation="MTRTQKSVFIAAAIVALILGVILSQVLPGRSSQDQAALNDAGIVL
FT                   LPKSRQLPALSMTDQNGAAVPLDGLKDQWTLMFFGYTFCPDICPTTLAQIKQIRSELPE
FT                   ETVKRMRVVLVSVDPNRDTPQQLKQYLGYFDPQYIGLTAPVADIQTLANAVSIPFIPAD
FT                   TGKPNYFVDHSGNLALIGPDGTQRGFIRAPLNNRKLVKQLPGLLGRD"
     MTRTQKSVFI AAAIVALILG VILSQVLPGR SSQDQAALND AGIVLLPKSR QLPALSMTDQ        60
     NGAAVPLDGL KDQWTLMFFG YTFCPDICPT TLAQIKQIRS ELPEETVKRM RVVLVSVDPN       120
     RDTPQQLKQY LGYFDPQYIG LTAPVADIQT LANAVSIPFI PADTGKPNYF VDHSGNLALI       180
     GPDGTQRGFI RAPLNNRKLV KQLPGLLGRD                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page