(data stored in ACNUC7421 zone)

EMBL: CP000075.PE285

CP000075.PE285       Location/Qualifiers
FT   CDS             complement(303388..303879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0285"
FT                   /product="Cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35358"
FT                   /db_xref="GOA:Q4ZZR4"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35358.1"
FT                   /translation="MSQPLLSKRLVLRLTCLIVIMLIGGLALPSLYGVLTGHDNALPGE
FT                   DASRQVEVQFTASNVAGMTWAFYPQASQMQVHPGTVNEMIFIAQNPTDRPMKAQAVPGI
FT                   SPGKAAAWFHKTECFCFTQQTLQPGERIEMPVRFIIDRDMPDDVKHLTLAYTLFDVTTP
FT                   "
     MSQPLLSKRL VLRLTCLIVI MLIGGLALPS LYGVLTGHDN ALPGEDASRQ VEVQFTASNV        60
     AGMTWAFYPQ ASQMQVHPGT VNEMIFIAQN PTDRPMKAQA VPGISPGKAA AWFHKTECFC       120
     FTQQTLQPGE RIEMPVRFII DRDMPDDVKH LTLAYTLFDV TTP                         163
//

If you have problems or comments...

PBIL Back to PBIL home page