(data stored in ACNUC7421 zone)

EMBL: CP000075.PE286

CP000075.PE286       Location/Qualifiers
FT   CDS             304127..304777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35359"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35359.1"
FT                   /translation="MNTAALREQIQLAHQHEARTGHLLQQLAQKLPHLHPAIHLPEVDA
FT                   KDVLARFVTAYIDLVPDLLDAAHEVALEAGIEGQIKPVLKIAEHFFAAPPSIMDGHEGL
FT                   ESLLDEAYLAHRLVEEVNDLYIKHFGQPLIPSNTTVASVIAHQLIGEQFANQLDEAVHH
FT                   AVDELLDEESFALDSVEAYREKLISPETGAAWQRWPSLSRQLGVGLELERSAV"
     MNTAALREQI QLAHQHEART GHLLQQLAQK LPHLHPAIHL PEVDAKDVLA RFVTAYIDLV        60
     PDLLDAAHEV ALEAGIEGQI KPVLKIAEHF FAAPPSIMDG HEGLESLLDE AYLAHRLVEE       120
     VNDLYIKHFG QPLIPSNTTV ASVIAHQLIG EQFANQLDEA VHHAVDELLD EESFALDSVE       180
     AYREKLISPE TGAAWQRWPS LSRQLGVGLE LERSAV                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page