(data stored in ACNUC7421 zone)

EMBL: CP000075.PE293

CP000075.PE293       Location/Qualifiers
FT   CDS             311440..313650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0293"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35366"
FT                   /db_xref="GOA:Q4ZZQ6"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35366.1"
FT                   /translation="MNTEALIEAAVQVDVPEATPVVEPDIEVIPAIEAPAAVVPAIVAP
FT                   NLDDSSLYIHRELSQLQFNIRVLEQALDESYPLLERLKFLLIFSSNLDEFFEIRVAGLK
FT                   KQITFAREQAGADGLQPHQALARISELVHGHVDRQYAILNDILLPELEKHQVRFIRRRH
FT                   WTAKLKAWVRRYFRDEIAPIITPIGLDPTHPFPLLVNKSLNFIVELEGIDAFGRDSGLA
FT                   IIPAPRLLPRVIKVPEEVCGPGDNFVFLSSMIHAHADDLFQGMKVKGCYQFRLTRNADL
FT                   ALDSEDVEDLARALRGELFSRRYGDAVRLEVADTCPKHLSDYLLKQFNLHESELYQVNG
FT                   PVNLTRLFSITGLDSHPELQYPPFTPAIPKLLQNSENVFSVVSKQDILLLHPFESFTPV
FT                   VDLLRQAAKDPHVLAVRQTLYRSGANSEIVDALVDAARNGKEVTAVIELRARFDEESNL
FT                   QLASRLQAAGAVVIYGVVGFKTHAKMMLILRREAGEIVRYAHLGTGNYHAGNARLYTDY
FT                   SLLTSDDALCEDVGKLFSQLIGMGKTLRMKKLLHAPFTLKKGMLDMIARETQFALDGKP
FT                   AHIIAKFNSLTDPKIIRALYKASQSGVRIDLVVRGMCCLRPGIAGVSHNIHVRSIIGRF
FT                   LEHTRVFYFLNGGDEQMFLSSADWMERNLDKRVETCFPVEGKKLILRVKKELESYLTDN
FT                   THSWLLQSDGRYVRSTPTGNQNPRSAQATLLERLSNPVLSVR"
     MNTEALIEAA VQVDVPEATP VVEPDIEVIP AIEAPAAVVP AIVAPNLDDS SLYIHRELSQ        60
     LQFNIRVLEQ ALDESYPLLE RLKFLLIFSS NLDEFFEIRV AGLKKQITFA REQAGADGLQ       120
     PHQALARISE LVHGHVDRQY AILNDILLPE LEKHQVRFIR RRHWTAKLKA WVRRYFRDEI       180
     APIITPIGLD PTHPFPLLVN KSLNFIVELE GIDAFGRDSG LAIIPAPRLL PRVIKVPEEV       240
     CGPGDNFVFL SSMIHAHADD LFQGMKVKGC YQFRLTRNAD LALDSEDVED LARALRGELF       300
     SRRYGDAVRL EVADTCPKHL SDYLLKQFNL HESELYQVNG PVNLTRLFSI TGLDSHPELQ       360
     YPPFTPAIPK LLQNSENVFS VVSKQDILLL HPFESFTPVV DLLRQAAKDP HVLAVRQTLY       420
     RSGANSEIVD ALVDAARNGK EVTAVIELRA RFDEESNLQL ASRLQAAGAV VIYGVVGFKT       480
     HAKMMLILRR EAGEIVRYAH LGTGNYHAGN ARLYTDYSLL TSDDALCEDV GKLFSQLIGM       540
     GKTLRMKKLL HAPFTLKKGM LDMIARETQF ALDGKPAHII AKFNSLTDPK IIRALYKASQ       600
     SGVRIDLVVR GMCCLRPGIA GVSHNIHVRS IIGRFLEHTR VFYFLNGGDE QMFLSSADWM       660
     ERNLDKRVET CFPVEGKKLI LRVKKELESY LTDNTHSWLL QSDGRYVRST PTGNQNPRSA       720
     QATLLERLSN PVLSVR                                                       736
//

If you have problems or comments...

PBIL Back to PBIL home page