(data stored in SCRATCH zone)

EMBL: CP000075.PE295

CP000075.PE295       Location/Qualifiers
FT   CDS             complement(315811..316545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0295"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35368"
FT                   /db_xref="GOA:Q4ZZQ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZQ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35368.1"
FT                   /translation="MPLLRISALHKYYGDHHVLKGIDLSVEEGQVVAIIGRSGSGKSTL
FT                   LRTLNGLESINDGVIEVDGEYLDAARADLRTLRQKVGMVFQQFNLFPHLSVGENVMLAP
FT                   QVVQKVPKAEAAKLARKMLERVGLGEKFDAFPDRLSGGQQQRVAIARALAMSPKVLLCD
FT                   EITSALDPELVNEVLSVVRQLAADGMTLIMVTHEMRFAREVGDKLVFMHQGKVHEVGDP
FT                   KELFANPKTPELANFIGTVEHA"
     MPLLRISALH KYYGDHHVLK GIDLSVEEGQ VVAIIGRSGS GKSTLLRTLN GLESINDGVI        60
     EVDGEYLDAA RADLRTLRQK VGMVFQQFNL FPHLSVGENV MLAPQVVQKV PKAEAAKLAR       120
     KMLERVGLGE KFDAFPDRLS GGQQQRVAIA RALAMSPKVL LCDEITSALD PELVNEVLSV       180
     VRQLAADGMT LIMVTHEMRF AREVGDKLVF MHQGKVHEVG DPKELFANPK TPELANFIGT       240
     VEHA                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page