(data stored in ACNUC7421 zone)

EMBL: CP000075.PE297

CP000075.PE297       Location/Qualifiers
FT   CDS             complement(317179..317844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0297"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35370"
FT                   /db_xref="GOA:Q4ZZQ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZQ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35370.1"
FT                   /translation="MAYHFDFTPVLQNLDVLLRGALFTLELTAIGTLLGVSLGIVGAVV
FT                   RAWKIQPFATIFAIYVELIRNTPFLVQLFFIFFGLPSLGVQITEWQAAVLAMVINLGAY
FT                   STEIVRAGIQAIPKGQLEASAALAMSRYEAFRHVVLVPALGKVWPALSSQIIIVMLGSA
FT                   VCSQIATEELSFFANFIQSRNFRSFETYIVTTLIYLAMALLIRQLLAWIGRRYISRNR"
     MAYHFDFTPV LQNLDVLLRG ALFTLELTAI GTLLGVSLGI VGAVVRAWKI QPFATIFAIY        60
     VELIRNTPFL VQLFFIFFGL PSLGVQITEW QAAVLAMVIN LGAYSTEIVR AGIQAIPKGQ       120
     LEASAALAMS RYEAFRHVVL VPALGKVWPA LSSQIIIVML GSAVCSQIAT EELSFFANFI       180
     QSRNFRSFET YIVTTLIYLA MALLIRQLLA WIGRRYISRN R                           221
//

If you have problems or comments...

PBIL Back to PBIL home page