(data stored in ACNUC7421 zone)

EMBL: CP000075.PE298

CP000075.PE298       Location/Qualifiers
FT   CDS             complement(317876..318661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0298"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35371"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35371.1"
FT                   /translation="MTKRYSALLTALFASLMLSQTPAHANGLDDVVARGTLKVAVPQDF
FT                   PPFGSVGPDMKPRGLDIDTAQLLADKLKVKLELTPVNSTNRIPFLTTGKVDLVISSLGK
FT                   NPDREKVIDFSRAYAPFYLAVFGPPDSPVKDIADLKGKTISVTRGAIEDIELSNVAPEG
FT                   ATIKRFEDNNSTIAAYLAGQTDLIASGNVVMVAISERNPKRIPAMKVKLKDSPVYVGVN
FT                   KGQPELLGKVNEILNAAKADGTLEKASQKWLKDPLPADL"
     MTKRYSALLT ALFASLMLSQ TPAHANGLDD VVARGTLKVA VPQDFPPFGS VGPDMKPRGL        60
     DIDTAQLLAD KLKVKLELTP VNSTNRIPFL TTGKVDLVIS SLGKNPDREK VIDFSRAYAP       120
     FYLAVFGPPD SPVKDIADLK GKTISVTRGA IEDIELSNVA PEGATIKRFE DNNSTIAAYL       180
     AGQTDLIASG NVVMVAISER NPKRIPAMKV KLKDSPVYVG VNKGQPELLG KVNEILNAAK       240
     ADGTLEKASQ KWLKDPLPAD L                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page