(data stored in ACNUC7421 zone)

EMBL: CP000075.PE304

CP000075.PE304       Location/Qualifiers
FT   CDS             324350..325018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0304"
FT                   /product="ChaC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35377"
FT                   /db_xref="GOA:Q4ZZP5"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35377.1"
FT                   /translation="MENPINELAAAVHDGLGLTYPPVIDMGPQLTREQLLASMNATMRR
FT                   HKGGPVWLFAYGSLIWRPECTAVESQRARVHGYHRGLYLWSHEHRGTPEVPGLVFGLDR
FT                   GGSCTGFAYRLPDECLEKSLLALWEREMPYPSYRPHWLNCRLEDGRKVQALGFVLERHL
FT                   PSYAGNLPDSVLSQVLASARGRYGTTREYVEQTAKALRSHAMPDLNLEARLKRCKSETA
FT                   "
     MENPINELAA AVHDGLGLTY PPVIDMGPQL TREQLLASMN ATMRRHKGGP VWLFAYGSLI        60
     WRPECTAVES QRARVHGYHR GLYLWSHEHR GTPEVPGLVF GLDRGGSCTG FAYRLPDECL       120
     EKSLLALWER EMPYPSYRPH WLNCRLEDGR KVQALGFVLE RHLPSYAGNL PDSVLSQVLA       180
     SARGRYGTTR EYVEQTAKAL RSHAMPDLNL EARLKRCKSE TA                          222
//

If you have problems or comments...

PBIL Back to PBIL home page