(data stored in ACNUC7421 zone)

EMBL: CP000075.PE307

CP000075.PE307       Location/Qualifiers
FT   CDS             complement(327895..328398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35380"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35380.1"
FT                   /translation="MDMHHFRCEGRCTMNQYEIENVIQSAIHGWLRLDVDLDYGSTAAA
FT                   MSKITRETSFSDLSKEYKPLDKNKLLASVFTSMIQKRLDIPDRFKKIYVDQLADAGIFV
FT                   GNVINKNIPNYPSTTVDAAYLEDAVNSELEYAVVKGIDFTPDVDTEIANAKTIGELAAM
FT                   IAKP"
     MDMHHFRCEG RCTMNQYEIE NVIQSAIHGW LRLDVDLDYG STAAAMSKIT RETSFSDLSK        60
     EYKPLDKNKL LASVFTSMIQ KRLDIPDRFK KIYVDQLADA GIFVGNVINK NIPNYPSTTV       120
     DAAYLEDAVN SELEYAVVKG IDFTPDVDTE IANAKTIGEL AAMIAKP                     167
//

If you have problems or comments...

PBIL Back to PBIL home page